Produkt-Browser

  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

GADD45A monoclonal antibody (M01), clone 3D12   

  • Katalog # : H00001647-M01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 ug
  • EUR € 299
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GADD45A.
  • Immunogen:
  • GADD45A (AAH11757, 76 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001647-M01
    Western Blot detection against Immunogen (35.53 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged GADD45A is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between MAP2K6 and GADD45A HeLa cells were stained with anti-MAP2K6 rabbit purified polyclonal 1:1200 and anti-GADD45A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1647
  • Gene Name:
  • GADD45A
  • Gene Alias:
  • DDIT1,GADD45
  • Gene Description:
  • growth arrest and DNA-damage-inducible, alpha
  • Gene Summary:
  • This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq
  • Other Designations:
  • DNA damage-inducible transcript 1,DNA damage-inducible transcript-1,DNA-damage-inducible transcript 1,OTTHUMP00000010979,growth arrest and DNA-damage-inducible 45 alpha
    Wenn Sie Fragen oder Kommentare haben, wählen Sie bitte ein Thema aus.

Ihre Nachricht wurde erfolgreich gesendet!