Produkt-Browser
CTSD purified MaxPab rabbit polyclonal antibody (D01P)
Katalog # : H00001509-D01P
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 289
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Rabbit polyclonal antibody raised against a full-length human CTSD protein.
Immunogen: CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein.
Sequence: MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Quality Control Testing: Antibody reactive against mammalian transfected lysate.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Tissue lysate) CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in human kidney.
Protocol Download
Western Blot (Tissue lysate) CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in mouse brain.
Protocol Download
Western Blot (Cell lysate) CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in IMR-32.
Protocol Download
Western Blot (Cell lysate) CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in A-431.
Protocol Download
Western Blot (Transfected lysate) Western Blot analysis of CTSD expression in transfected 293T cell line (H00001509-T01 ) by CTSD MaxPab polyclonal antibody.
Protocol Download
Western Blot (Tissue lysate)
enlarge
Western Blot (Tissue lysate)
enlarge
Western Blot (Transfected lysate)
enlarge
Gene Alias: CLN10,CPSD,MGC2311
Gene Description: cathepsin D
Gene Summary: This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease. [provided by RefSeq
Other Designations: lysosomal aspartyl peptidase,lysosomal aspartyl protease
Click this icon to add products to compare list. Select up to 10 products.
Download
