Produkt-Browser

  • Related Product Showcase
  • By Research Area

  • By Biomarker
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CSE1L polyclonal antibody (A01)   

  • Katalog # : H00001434-A01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 50 uL
  • EUR € 195
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CSE1L.
  • Immunogen:
  • CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CSE1L polyclonal antibody (A01), Lot # 050722JC01. Western Blot analysis of CSE1L expression in PC-12.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CSE1L polyclonal antibody (A01), Lot # 050722JC01. Western Blot analysis of CSE1L expression in Raw 264.7.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CSE1L polyclonal antibody (A01), Lot # 050722JC01 Western Blot analysis of CSE1L expression in Jurkat ( Cat # L017V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CSE1L polyclonal antibody (A01), Lot # 050722JC01. Western Blot analysis of CSE1L expression in NIH/3T3.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1434
  • Gene Name:
  • CSE1L
  • Gene Alias:
  • CAS,CSE1,MGC117283,MGC130036,MGC130037,XPO2
  • Gene Description:
  • CSE1 chromosome segregation 1-like (yeast)
  • Gene Summary:
  • Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq
  • Other Designations:
  • CSE1 chromosome segregation 1-like protein,OTTHUMP00000043373,cellular apoptosis susceptibility protein,chromosome segregation 1-like,importin-alpha re-exporter
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!