Produkt-Browser

  • Related Product Showcase
  • By Research Area
  • By Antibody/Protein
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CRHBP MaxPab rabbit polyclonal antibody (D01)   MaxPab

  • Katalog # : H00001393-D01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 uL
  • EUR € 289
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CRHBP protein.
  • Immunogen:
  • CRHBP (NP_001873.2, 1 a.a. ~ 322 a.a) full-length human protein.
  • Sequence:
  • MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CRHBP MaxPab rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CRHBP expression in transfected 293T cell line (H00001393-T01) by CRHBP MaxPab polyclonal antibody.

    Lane 1: CRHBP transfected lysate(36.10 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CRHBP transfected lysate using anti-CRHBP MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CRHBP MaxPab mouse polyclonal antibody (B01) (H00001393-B01).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1393
  • Gene Name:
  • CRHBP
  • Gene Alias:
  • CRF-BP,CRFBP
  • Gene Description:
  • corticotropin releasing hormone binding protein
  • Gene Summary:
  • Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq
  • Other Designations:
  • corticotropin releasing hormone-binding protein
    Wenn Sie Fragen oder Kommentare haben, wählen Sie bitte ein Thema aus.

Ihre Nachricht wurde erfolgreich gesendet!