Produkt-Browser
CD74 monoclonal antibody (M02), clone 2F8
Katalog # : H00000972-M02
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a full-length recombinant CD74.
Immunogen: CD74 (AAH24272, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged CD74 is 1 ng/ml as a capture antibody.
Protocol Download
Sandwich ELISA (Recombinant protein)
enlarge
Gene Alias: DHLAG,HLADG,Ia-GAMMA
Gene Description: CD74 molecule, major histocompatibility complex, class II invariant chain
Other Designations: CD74 antigen,CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated),HLA-DR-gamma,Ia-associated invariant chain,MHC HLA-DR gamma chain,gamma chain of class II antigens
Click this icon to add products to compare list. Select up to 10 products.
