Produkt-Browser

  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

BID purified MaxPab rabbit polyclonal antibody (D01P)   MaxPab

  • Katalog # : H00000637-D01P
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 ug
  • EUR € 289
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human BID protein.
  • Immunogen:
  • BID (NP_001187.1, 1 a.a. ~ 195 a.a) full-length human protein.
  • Sequence:
  • MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BID MaxPab rabbit polyclonal antibody. Western Blot analysis of BID expression in Jurkat.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BID expression in transfected 293T cell line (H00000637-T01) by BID MaxPab polyclonal antibody.

    Lane 1: BID transfected lysate(22.00 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between BID and BAX. HeLa cells were stained with anti-BID rabbit purified polyclonal 1:1200 and anti-BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 637
  • Gene Name:
  • BID
  • Gene Alias:
  • FP497,MGC15319,MGC42355
  • Gene Description:
  • BH3 interacting domain death agonist
  • Gene Summary:
  • This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq
  • Other Designations:
  • BH3-interacting domain death agonist,BID isoform ES(1b),BID isoform L(2),BID isoform Si6,Human BID coding sequence,OTTHUMP00000196197,apoptic death agonist,desmocollin type 4
  • Interactome
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!