- Products
- Services
- Support
- Zusammenarbeit
- Über uns
Produkt-Browser
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
 |
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Enzyme > Others > AMPD2 monoclonal antibody (M09A), clone 6A8
AMPD2 monoclonal antibody (M09A), clone 6A8
- Katalog # : H00000271-M09A
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 200 uL
- EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte :
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant AMPD2.
- Immunogen:
- AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG2a Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
- Storage Buffer:
- In ascites fluid
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Tissue lysate)
- AMPD2 monoclonal antibody (M09A), clone 6A8. Western Blot analysis of AMPD2 expression in human kidney.
- Protocol Download
- Western Blot (Tissue lysate)
- AMPD2 monoclonal antibody (M09A), clone 6A8. Western Blot analysis of AMPD2 expression in human liver.
- Protocol Download
- Western Blot (Cell lysate)
- AMPD2 monoclonal antibody (M09A), clone 6A8. Western Blot analysis of AMPD2 expression in HeLa(Cat # L013V1 ).
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M09A), clone 6A8.
Lane 1: AMPD2 transfected lysate(92.1 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Entrez GeneID:
- 271
- GeneBank Accession#:
- NM_139156
- Protein Accession#:
- NP_631895
- Gene Name:
- AMPD2
- Gene Alias:
- -
- Gene Description:
- adenosine monophosphate deaminase 2 (isoform L)
- Omim ID:
- 102771
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM
- Other Designations:
- AMP deaminase 2,OTTHUMP00000013369,OTTHUMP00000013371
- Related Disease
