Produkt-Browser
ALPPL2 polyclonal antibody (A01)
Katalog # : H00000251-A01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
50 uL
EUR € 195
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse polyclonal antibody raised against a partial recombinant ALPPL2.
Immunogen: ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag.
Sequence: SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: 50 % glycerol
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Recombinant protein)
Gene Alias: ALPG,ALPPL,GCAP
Gene Description: alkaline phosphatase, placental-like 2
Gene Summary: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq
Other Designations: Nagao isozyme,germ cell alkaline phosphatase,placental-like alkaline phosphatase,testicular and thymus alkaline phosphatase
Click this icon to add products to compare list. Select up to 10 products.
Download
