Produkt-Browser

  • Related Product Showcase
  • By Hot Target
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ALDH1A1 (Human) Recombinant Protein (Q01)   

  • Katalog # : H00000216-Q01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 10 ug
  • EUR € 279
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • 25 ug
  • EUR € 425
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human ALDH1A1 partial ORF ( AAH01505, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000216-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 216
  • Gene Name:
  • ALDH1A1
  • Gene Alias:
  • ALDC,ALDH-E1,ALDH1,ALDH11,MGC2318,PUMB1,RALDH1
  • Gene Description:
  • aldehyde dehydrogenase 1 family, member A1
  • Gene Summary:
  • This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq
  • Other Designations:
  • ALDH class 1,acetaldehyde dehydrogenase 1,aldehyde dehydrogenase 1, soluble,aldehyde dehydrogenase 1A1,aldehyde dehydrogenase, liver cytosolic,retinal dehydrogenase 1,retinaldehyde dehydrogenase 1
    Wenn Sie Fragen oder Kommentare haben, wählen Sie bitte ein Thema aus.

Ihre Nachricht wurde erfolgreich gesendet!