Produkt-Browser
AKT2 monoclonal antibody (M04A), clone 1F8
Katalog # : H00000208-M04A
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
200 uL
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a partial recombinant AKT2.
Immunogen: AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Reactivity:
Human, Mouse, Rat
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In ascites fluid
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Cell lysate) AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in PC-12(Cat # L012V1 ).
Protocol Download
Western Blot (Cell lysate) AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in Raw 264.7(Cat # L024V1 ).
Protocol Download
Western Blot (Cell lysate) AKT2 monoclonal antibody (M04A), clone 1F8 Western Blot analysis of AKT2 expression in Jurkat ( Cat # L017V1 ).
Protocol Download
Western Blot (Cell lysate) AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in NIH/3T3(Cat # L018V1 ).
Protocol Download
Western Blot (Recombinant protein)
Gene Alias: PKBB,PKBBETA,PRKBB,RAC-BETA
Gene Description: v-akt murine thymoma viral oncogene homolog 2
Gene Summary: This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. [provided by RefSeq
Other Designations: Murine thymoma viral (v-akt) homolog-2,rac protein kinase beta
Click this icon to add products to compare list. Select up to 10 products.
Download
