Produkt-Browser
ADCY5 (Human) Recombinant Protein (Q01)
Katalog # : H00000111-Q01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
2 ug
EUR € 189
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Human ADCY5 partial ORF ( NP_899200, 1152 a.a. - 1261 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence: ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Theoretical MW (kDa): 37.84
Purification: Glutathione Sepharose 4 Fast Flow
Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Gene Description: adenylate cyclase 5
Gene Summary: ADCY5 belongs to the adenylate cyclase (EC 4.6.1.1) family of enzymes responsible for the synthesis of cAMP (Ludwig and Seuwen, 2002 [PubMed 12503609]).[supplied by OMIM
Other Designations: adenylate cyclase, type V
Click this icon to add products to compare list. Select up to 10 products.
Download
