Produkt-Browser

  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Disease
  • By Biomarker
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ABL2 monoclonal antibody (M04), clone 3G3   

  • Katalog # : H00000027-M04
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 ug
  • EUR € 299
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ABL2.
  • Immunogen:
  • ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000027-M04
    Western Blot detection against Immunogen (36.41 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ABL2 monoclonal antibody (M04), clone 3G3 Western Blot analysis of ABL2 expression in Hela NE ( Cat # L013V3 ).
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ABL2 is approximately 0.3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 27
  • Gene Name:
  • ABL2
  • Gene Alias:
  • ABLL,ARG,FLJ22224,FLJ31718,FLJ41441
  • Gene Description:
  • v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
  • Gene Summary:
  • This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Abelson murine leukemia viral (v-abl) oncogene homolog 2,Abelson-related gene protein,OTTHUMP00000033139,arg tyrosine kinase,v-abl Abelson murine leukemia viral oncogene homolog 2
  • Interactome
  • Gene Pathway
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!