Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
RPP40 MaxPab mouse polyclonal antibody (B01) 
- Katalog # : H00010799-B01
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 50 uL
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse polyclonal antibody raised against a full-length human RPP40 protein.
- Immunogen:
- RPP40 (AAH17871.1, 1 a.a. ~ 244 a.a) full-length human protein.
- Sequence:
- MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- No additive
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Note:
- For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
- Western Blot (Tissue lysate)
- RPP40 MaxPab polyclonal antibody. Western Blot analysis of RPP40 expression in human kidney.
-
Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of RPP40 expression in transfected 293T cell line (H00010799-T01) by RPP40 MaxPab polyclonal antibody.
Lane 1: RPP40 transfected lysate(26.84 KDa).
Lane 2: Non-transfected lysate.
-
Protocol Download
- Western Blot (Tissue lysate)
- enlarge
- Western Blot (Transfected lysate)
- enlarge
- Gene Alias:
- RNASEP1,bA428J1.3
- Gene Description:
- ribonuclease P/MRP 40kDa subunit
- Other Designations:
- ribonuclease P (40 kD),ribonuclease P 40kDa subunit,ribonuclease P, 40kD subunit,ribonuclease P1
Download
enlarge this image
