Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
ANGPTL7 monoclonal antibody (M04), clone 2C6
- Katalog # : H00010218-M04
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant ANGPTL7.
- Immunogen:
- ANGPTL7 (NP_066969, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Recombinant protein)
- Gene Alias:
- AngX,CDT6,RP4-647M16.2,dJ647M16.1
- Gene Description:
- angiopoietin-like 7
- Other Designations:
- OTTHUMP00000001986,angiopoietin-like factor (CDT6)
enlarge this image
