Produkt-Browser
APLN (Human) Recombinant Protein (P01)
Katalog # : H00008862-P01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
2 ug
EUR € 189
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Human AAPLN full-length ORF (AAH21104.1, 1 a.a. ~ 122 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence: MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Theoretical MW (kDa): 39.16
Purification: Glutathione Sepharose 4 Fast Flow
Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Gene Summary: Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM
Other Designations: apelin, AGTRL1 ligand,peptide ligand for APJ receptor
Click this icon to add products to compare list. Select up to 10 products.
Download
