Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
TRPC1 monoclonal antibody (M03A), clone 1E4
- Katalog # : H00007220-M03A
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 200 uL
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant TRPC1.
- Immunogen:
- TRPC1 (NP_003295, 442 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.78 KDa) .
- Storage Buffer:
- In ascites fluid
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Recombinant protein)
- Gene Alias:
- HTRP-1,MGC133334,MGC133335,TRP1
- Gene Description:
- transient receptor potential cation channel, subfamily C, member 1
- Other Designations:
- transient receptor potential channel 1
