Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
XCL1 monoclonal antibody (M01), clone 1E1
- Katalog # : H00006375-M01
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant XCL1.
- Immunogen:
- XCL1 (NP_002986, 22 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to XCL1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
-
Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged XCL1 is approximately 30ng/ml as a capture antibody.
-
Protocol Download
- Western Blot (Recombinant protein)
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- enlarge
- Sandwich ELISA (Recombinant protein)
- Gene Alias:
- ATAC,LPTN,LTN,SCM-1,SCM-1a,SCM1,SCYC1
- Gene Description:
- chemokine (C motif) ligand 1
- Other Designations:
- OTTHUMP00000032498,OTTHUMP00000060404,lymphotactin,small inducible cytokine subfamily C, member 1 (lymphotactin)
Download
