Produkt-Browser
CCNC MaxPab mouse polyclonal antibody (B01)
Katalog # : H00000892-B01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
50 uL
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse polyclonal antibody raised against a full-length human CCNC protein.
Immunogen: CCNC (AAH56153.1, 1 a.a. ~ 283 a.a) full-length human protein.
Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Quality Control Testing: Antibody reactive against mammalian transfected lysate.
Storage Buffer: No additive
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Western Blot (Transfected lysate) Western Blot analysis of CCNC expression in transfected 293T cell line (H00003956-T02 ) by CCNC MaxPab polyclonal antibody.
Protocol Download
Western Blot (Transfected lysate)
enlarge
Gene Description: cyclin C
Gene Summary: The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations: OTTHUMP00000016897
Click this icon to add products to compare list. Select up to 10 products.
Download
