Produkt-Browser
APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
Katalog # : H00000328-D02P
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 289
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Rabbit polyclonal antibody raised against a full-length human APEX1 protein.
Immunogen: APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein.
Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Quality Control Testing: Antibody reactive against mammalian transfected lysate.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Cell lysate) APEX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562.
Protocol Download
Western Blot (Transfected lysate) Western Blot analysis of APEX1 expression in transfected 293T cell line (H00000328-T04 ) by APEX1 MaxPab polyclonal antibody.
Protocol Download
Western Blot (Transfected lysate)
enlarge
Gene Alias: APE,APE-1,APE1,APEN,APEX,APX,HAP1,REF-1,REF1
Gene Description: APEX nuclease (multifunctional DNA repair enzyme) 1
Gene Summary: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq
Other Designations: AP endonuclease class I,AP lyase,APEX nuclease,DNA-(apurinic or apyrimidinic site) lyase,OTTHUMP00000163988,apurinic/apyrimidinic (abasic) endonuclease,apurinic/apyrimidinic exonuclease,deoxyribonuclease (apurinic or apyrimidinic),multifunctional DNA repa
Acute Disease Adenocarcinoma Adenomatous Polyposis Coli Adenomyoma Alzheimer Disease Alzheimer disease Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Anoxia Arsenic Poisoning Ataxia telangiectasia Biliary Tract Neoplasms Brain Neoplasms Breast cancer Breast Neoplasms Carcinoma, Non-Small-Cell Lung Carcinoma, Pancreatic Ductal Carcinoma, Squamous Cell Carcinoma, Transitional Cell
Cerebrovascular Accident Chromosome Aberrations Chronic Disease Cleft Lip Cleft Palate Colon cancer Colorectal Neoplasms Diabetes Mellitus, Type 1 Diabetic Nephropathies Disease Progression Disease Susceptibility DNA Damage Endometriosis Esophageal Neoplasms Fibrosis Gallstones Genetic Predisposition to Disease Glioma Graft vs Host Disease Graves Disease Head and Neck Neoplasms Helicobacter Infections Kidney Failure, Chronic Laryngeal Neoplasms Leukemia Leukemia, Lymphocytic, Acute Leukemia, Myelocytic, Acute Leukemia, Myeloid Lung Neoplasms Lymphatic Metastasis Lymphoma, Follicular Lymphoma, Large B-Cell, Diffuse Malignant melanoma Melanoma Meningeal Neoplasms Meningioma Micronuclei, Chromosome-Defective Mouth Abnormalities Mouth Neoplasms Multiple Sclerosis Myocardial Infarction Neoplasm Recurrence, Local Neoplasms Neoplasms, Glandular and Epithelial Neuroma, Acoustic Ovarian cancer Ovarian Neoplasms Pancreatic cancer Pancreatic Neoplasms Papillomavirus Infections Pharyngeal Neoplasms Precancerous Conditions Pre-Eclampsia Prostate cancer Prostatic Neoplasms Pulmonary Disease, Chronic Obstructive Radiation Injuries Skin Diseases Skin Neoplasms Spinal Dysraphism Stomach Neoplasms Stroke Thyroid Neoplasms Urinary Bladder Neoplasms Uterine Cervical Neoplasms Werner syndrome
Click this icon to add products to compare list. Select up to 10 products.
Download
