FADD polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Human cell line RT-4 with FADD polyclonal antibody (Cat # PAB29367) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human gallbladder with FADD polyclonal antibody (Cat # PAB29367) shows cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with FADD polyclonal antibody (Cat # PAB29367) at 1-4 ug/mL concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human FADD.
Immunogen
Recombinant protein corresponding to human FADD.
Sequence
LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Human cell line RT-4 with FADD polyclonal antibody (Cat # PAB29367) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human gallbladder with FADD polyclonal antibody (Cat # PAB29367) shows cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with FADD polyclonal antibody (Cat # PAB29367) at 1-4 ug/mL concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli. -
Gene Info — FADD
Entrez GeneID
8772Gene Name
FADD
Gene Alias
GIG3, MGC8528, MORT1
Gene Description
Fas (TNFRSF6)-associated via death domain
Omim ID
602457Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq
Other Designations
Fas-associated via death domain|Fas-associating death domain-containing protein|Fas-associating protein with death domain|growth-inhibiting gene 3 protein|mediator of receptor-induced toxicity
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com