CYCS purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYCS expression in transfected 293T cell line (H00054205-T02) by CYCS MaxPab polyclonal antibody.
Lane 1: CYCS transfected lysate(11.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CYCS and CASP9. HeLa cells were stained with anti-CYCS rabbit purified polyclonal 1:1200 and anti-CASP9 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CYCS protein.
Immunogen
CYCS (NP_061820.1, 1 a.a. ~ 105 a.a) full-length human protein.
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYCS expression in transfected 293T cell line (H00054205-T02) by CYCS MaxPab polyclonal antibody.
Lane 1: CYCS transfected lysate(11.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CYCS and CASP9. HeLa cells were stained with anti-CYCS rabbit purified polyclonal 1:1200 and anti-CASP9 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CYCS
Entrez GeneID
54205GeneBank Accession#
NM_018947Protein Accession#
NP_061820.1Gene Name
CYCS
Gene Alias
CYC, HCS
Gene Description
cytochrome c, somatic
Omim ID
123970Gene Ontology
HyperlinkGene Summary
This gene encodes cytochrome c, a component of the electron transport chain in mitochondria. The heme group of cytochrome c accepts electrons from the b-c1 complex and transfers electrons to the cytochrome oxidase complex. Cytochrome c is also involved in initiation of apoptosis. Upon release of cytochrome c to the cytoplasm, the protein binds apoptotic protease activating factor which activates the apoptotic initiator procaspase 9. Many cytochrome c pseudogenes exist, scattered throughout the human genome. [provided by RefSeq
Other Designations
cytochrome c
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com