GOLM1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GOLM1 protein.
Immunogen
GOLM1 (NP_057632.2, 1 a.a. ~ 401 a.a) full-length human protein.
Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GOLM1 MaxPab polyclonal antibody. Western Blot analysis of GOLM1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of GOLM1 expression in transfected 293T cell line (H00051280-T01) by GOLM1 MaxPab polyclonal antibody.
Lane 1: GOLM1 transfected lysate(44.11 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GOLM1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GOLM1
Entrez GeneID
51280GeneBank Accession#
NM_016548.2Protein Accession#
NP_057632.2Gene Name
GOLM1
Gene Alias
C9orf155, FLJ22634, FLJ23608, GOLPH2, GP73, PSEC0257, bA379P1.3
Gene Description
golgi membrane protein 1
Omim ID
606804Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000021587|golgi membrane protein GP73|golgi phosphoprotein 2|golgi protein, 73-kD
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com