PTPN22 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PTPN22 full-length ORF ( AAH17785, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.43
Interspecies Antigen Sequence
Mouse (60); Rat (63)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PTPN22
Entrez GeneID
26191GeneBank Accession#
BC017785Protein Accession#
AAH17785Gene Name
PTPN22
Gene Alias
LYP, Lyp1, Lyp2, PEP, PTPN8
Gene Description
protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Gene Ontology
HyperlinkGene Summary
This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000013720|lymphoid-specific protein tyrosine phosphatase|protein tyrosine phosphatase, non-receptor type 8
-
Interactome
-
Disease
-
Publication Reference
-
Measuring the specific activity of the protein tyrosine phosphatase Lyp.
Bayley R, Yang P, Buckley CD, Young SP.
Journal of Immunological Methods 2012 Feb; 388(1-2):33.
Application:ELISA, Recombinant protein.
-
Measuring the specific activity of the protein tyrosine phosphatase Lyp.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com