PTPN22 monoclonal antibody (M01), clone 4F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PTPN22.
Immunogen
PTPN22 (AAH17785, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (60); Rat (63)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PTPN22 expression in transfected 293T cell line by PTPN22 monoclonal antibody (M01), clone 4F6.
Lane 1: PTPN22 transfected lysate(85.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTPN22 is 1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PTPN22 over-expressed 293 cell line, cotransfected with PTPN22 Validated Chimera RNAi ( Cat # H00026191-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PTPN22 monoclonal antibody (M01), clone 4F6 (Cat # H00026191-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PTPN22
Entrez GeneID
26191GeneBank Accession#
BC017785Protein Accession#
AAH17785Gene Name
PTPN22
Gene Alias
LYP, Lyp1, Lyp2, PEP, PTPN8
Gene Description
protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Gene Ontology
HyperlinkGene Summary
This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000013720|lymphoid-specific protein tyrosine phosphatase|protein tyrosine phosphatase, non-receptor type 8
-
Interactome
-
Disease
-
Publication Reference
-
Protein tyrosine phosphatase receptor type R (PTPRR) antagonizes the Wnt signaling pathway in ovarian cancer by dephosphorylating and inactivating β-catenin.
Wang Y, Cao J, Liu W, Zhang J, Wang Z, Zhang Y, Hou L, Chen S, Hao P, Zhang L, Zhuang M, Yu Y, Li D, Fan G.
The Journal of Biological Chemistry 2019 Nov; 294(48):18306.
Application:WB-Ce, Human, HOSE 6-3, HOSE 11-12, Ovarian carcinoma-derived cell lines.
-
Experimental ischemia/reperfusion model impairs endocannabinoid signaling and Na+/K+ ATPase expression and activity in kidney proximal tubule cells.
Sampaio LS, Iannotti FA, Veneziani L, Borelli-Tôrres RT, De Maio F, Piscitelli F, Reis RAM, Di Marzo V, Einicker-Lamas M.
Biochemical Pharmacology 2018 Aug; 154:482.
Application:WB-Ce, Pig, LLC-PK1 cells.
-
Protein tyrosine phosphatase receptor type R (PTPRR) antagonizes the Wnt signaling pathway in ovarian cancer by dephosphorylating and inactivating β-catenin.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com