PPM1F polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPM1F.
Immunogen
PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Sequence
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPM1F polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of PPM1F expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPM1F
Entrez GeneID
9647GeneBank Accession#
NM_014634Protein Accession#
NP_055449Gene Name
PPM1F
Gene Alias
CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2
Gene Description
protein phosphatase 1F (PP2C domain containing)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq
Other Designations
Ca(2+)/calmodulin-dependent protein kinase phosphatase|CaM-kinase phosphatase|PP2C phosphatase|partner of PIX 2|protein phosphatase 1F
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com