PSCD3 monoclonal antibody (M01), clone 6D3-1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PSCD3 monoclonal antibody (M01), clone 6D3-1A9 Western Blot analysis of PSCD3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody (M01), clone 6D3-1A9.
Lane 1: PSCD3 transfected lysate(46.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSCD3 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (45.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PSCD3.
Immunogen
PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSCD3 monoclonal antibody (M01), clone 6D3-1A9 Western Blot analysis of PSCD3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody (M01), clone 6D3-1A9.
Lane 1: PSCD3 transfected lysate(46.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSCD3 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CYTH3
Entrez GeneID
9265GeneBank Accession#
BC008191Protein Accession#
AAH08191Gene Name
CYTH3
Gene Alias
ARNO3, GRP1, PSCD3
Gene Description
cytohesin 3
Omim ID
605081Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq
Other Designations
ARF nucleotide-binding site opener 3|general receptor of phosphoinositides 1|pleckstrin homology, Sec7 and coiled-coil domains 3|pleckstrin homology, Sec7 and coiled/coil domains 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com