FADD monoclonal antibody (M02), clone 3C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FADD.
Immunogen
FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (68)
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FADD expression in transfected 293T cell line by FADD monoclonal antibody (M02), clone 3C3.
Lane 1: FADD transfected lysate (Predicted MW: 23.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FADD is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FADD
Entrez GeneID
8772GeneBank Accession#
BC000334Protein Accession#
AAH00334Gene Name
FADD
Gene Alias
GIG3, MGC8528, MORT1
Gene Description
Fas (TNFRSF6)-associated via death domain
Omim ID
602457Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq
Other Designations
Fas-associated via death domain|Fas-associating death domain-containing protein|Fas-associating protein with death domain|growth-inhibiting gene 3 protein|mediator of receptor-induced toxicity
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com