FADD purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FADD protein.
Immunogen
FADD (NP_003815.1, 1 a.a. ~ 208 a.a) full-length human protein.
Sequence
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FADD MaxPab rabbit polyclonal antibody. Western Blot analysis of FADD expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of FADD expression in transfected 293T cell line (H00008772-T01) by FADD MaxPab polyclonal antibody.
Lane 1: FADD transfected lysate(23.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FADD and BID. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-BID mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — FADD
Entrez GeneID
8772GeneBank Accession#
NM_003824Protein Accession#
NP_003815.1Gene Name
FADD
Gene Alias
GIG3, MGC8528, MORT1
Gene Description
Fas (TNFRSF6)-associated via death domain
Omim ID
602457Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq
Other Designations
Fas-associated via death domain|Fas-associating death domain-containing protein|Fas-associating protein with death domain|growth-inhibiting gene 3 protein|mediator of receptor-induced toxicity
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com