STAT3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human STAT3 partial ORF ( NP_003141, 670 a.a. - 769 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — STAT3
Entrez GeneID
6774GeneBank Accession#
NM_003150Protein Accession#
NP_003141Gene Name
STAT3
Gene Alias
APRF, FLJ20882, HIES, MGC16063
Gene Description
signal transducer and activator of transcription 3 (acute-phase response factor)
Omim ID
102582Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
DNA-binding protein APRF|acute-phase response factor|signal transducer and activator of transcription 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Quantification of total and phosphorylated STAT3 by calibrated western blotting.
Nadine Köhler, Niloufarsadat Miri, Anna Dittrich.
STAR Protocols 2023 Sep; 4(3):102508.
Application:Calibrator, Quant, Human, HEK293 cells.
-
Response to IL-6 trans- and IL-6 classic signalling is determined by the ratio of the IL-6 receptor α to gp130 expression: fusing experimental insights and dynamic modelling.
Reeh H, Rudolph N, Billing U, Christen H, Streif S, Bullinger E, Schliemann-Bullinger M, Findeisen R, Schaper F, Huber HJ, Dittrich A.
Cell Communication and Signaling 2019 May; 17(1):46.
Application:Quant, WB-Re, Recombinant protein.
-
Quantification of total and phosphorylated STAT3 by calibrated western blotting.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com