SPINK1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SPINK1 full-length ORF ( NP_003113.2, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.9
Interspecies Antigen Sequence
Mouse (69)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPINK1
Entrez GeneID
6690GeneBank Accession#
NM_003122.2Protein Accession#
NP_003113.2Gene Name
SPINK1
Gene Alias
PCTT, PSTI, Spink3, TATI
Gene Description
serine peptidase inhibitor, Kazal type 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq
Other Designations
pancreatic secretory trypsin inhibitor|serine protease inhibitor, Kazal type 1|tumor-associated trypsin inhibitor
-
Interactome
-
Disease
-
Publication Reference
-
SPINK1-induced tumor plasticity provides a therapeutic window for chemotherapy in hepatocellular carcinoma.
Ki-Fong Man, Lei Zhou, Huajian Yu, Ka-Hei Lam, Wei Cheng, Jun Yu, Terence K Lee, Jing-Ping Yun, Xin-Yuan Guan, Ming Liu, Stephanie Ma.
Nature Communications 2023 Nov; 14(1):7863.
Application:Recombinant proteins, Human, MHCC97L cells.
-
SPINK1 as a plasma marker for tumor hypoxia and a therapeutic target for radiosensitization.
Tatsuya Suwa, Minoru Kobayashi, Yukari Shirai, Jin-Min Nam, Yoshiaki Tabuchi, Norihiko Takeda, Shusuke Akamatsu, Osamu Ogawa, Takashi Mizowaki, Ester M Hammond, Hiroshi Harada.
JCI Insight 2021 Nov; 6(21):e148135.
Application:Func, Human, DU 145 cells.
-
Targeting SPINK1 in the damaged tumour microenvironment alleviates therapeutic resistance.
Chen F, Long Q, Fu D, Zhu D, Ji Y, Han L, Zhang B, Xu Q, Liu B, Li Y, Wu S, Yang C, Qian M, Xu J, Liu S, Cao L, Chin YE, Lam EW, Coppé JP, Sun Y.
Nature Communications 2018 Oct; 9(1):4315.
Application:Func, Human, DU145, LNCap, M12, PC3 cells.
-
SPINK1-induced tumor plasticity provides a therapeutic window for chemotherapy in hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com