SMN2 monoclonal antibody (M01), clone 2B11-2A9

Catalog # H00006607-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

SMN2 monoclonal antibody (M01), clone 2B11-2A9. Western Blot analysis of SMN2 expression in human colon.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMN2 monoclonal antibody (M01), clone 2B11-2A9 Western Blot analysis of SMN2 expression in IMR-32 ( Cat # L008V1 ).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 1 ~ 10 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged SMN2 is approximately 0.3ng/ml as a capture antibody.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to SMN2 on HeLa cell. [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (56.76 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a full length recombinant SMN2.

    Immunogen

    SMN2 (AAH00908, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG2a kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (56.76 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    SMN2 monoclonal antibody (M01), clone 2B11-2A9. Western Blot analysis of SMN2 expression in human colon.

    Western Blot (Cell lysate)

    SMN2 monoclonal antibody (M01), clone 2B11-2A9 Western Blot analysis of SMN2 expression in IMR-32 ( Cat # L008V1 ).

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 1 ~ 10 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged SMN2 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to SMN2 on HeLa cell. [antibody concentration 10 ug/ml]
  • Gene Info — SMN2

    Entrez GeneID

    6607

    GeneBank Accession#

    BC000908

    Protein Accession#

    AAH00908

    Gene Name

    SMN2

    Gene Alias

    BCD541, C-BCD541, FLJ76644, MGC20996, MGC5208, SMNC

    Gene Description

    survival of motor neuron 2, centromeric

    Omim ID

    601627

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. While mutations in the telomeric copy are associated with spinal muscular atrophy, mutations in this gene, the centromeric copy, do not lead to disease. This gene may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The full length protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Four transcript variants encoding distinct isoforms have been described. [provided by RefSeq

    Other Designations

    OTTHUMP00000125236|OTTHUMP00000125237|gemin 1

  • Interactome
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All