S100A11 monoclonal antibody (M01), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant S100A11.
Immunogen
S100A11 (AAH14354, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to S100A11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A11 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A11 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — S100A11
Entrez GeneID
6282GeneBank Accession#
BC014354Protein Accession#
AAH14354Gene Name
S100A11
Gene Alias
MLN70, S100C
Gene Description
S100 calcium binding protein A11
Omim ID
603114Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq
Other Designations
OTTHUMP00000015271|S100 calcium-binding protein A11 (calgizzarin)|calgizzarin
-
Interactome
-
Disease
-
Publication Reference
-
S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
Li J, Riau AK, Setiawan M, Mehta JS, Ti SE, Tong L, Tan DT, Beuerman RW.
Molecular Vision 2011 Aug; 17:2263.
Application:IF, Human, Corneal-limbal epithelial cells, Ocular surface squamous cell carcinoma tissues.
-
S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com