RAD1 monoclonal antibody (M01J), clone 1G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAD1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M01J), clone 1G2.
Lane 1: RAD1 transfected lysate(32.43 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD1 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD1 over-expressed 293 cell line, cotransfected with RAD1 Validated Chimera RNAi ( Cat # H00005810-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD1 monoclonal antibody (M01), clone 1G2 (Cat # H00005810-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RAD1
Entrez GeneID
5810GeneBank Accession#
BC006837Protein Accession#
AAH06837Gene Name
RAD1
Gene Alias
HRAD1, REC1
Gene Description
RAD1 homolog (S. pombe)
Omim ID
603153Gene Ontology
HyperlinkGene Summary
This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq
Other Designations
DNA repair exonuclease REC1|OTTHUMP00000115992|RAD1 homolog|Rad1-like DNA damage checkpoint|cell cycle checkpoint protein Hrad1|checkpoint control protein HRAD1|exonuclease homolog RAD1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com