HSPB1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HSPB1 full-length ORF ( NP_001531.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.2
Interspecies Antigen Sequence
Mouse (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HSPB1
Entrez GeneID
3315GeneBank Accession#
NM_001540.2Protein Accession#
NP_001531.1Gene Name
HSPB1
Gene Alias
CMT2F, DKFZp586P1322, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Gene Description
heat shock 27kDa protein 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
Other Designations
OTTHUMP00000024846|estrogen-regulated 24 kDa protein|heat shock 27kD protein 1|heat shock protein beta-1|stress-responsive protein 27
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Global Impact of Salmonella Pathogenicity Island 2-secreted Effectors on the Host Phosphoproteome.
Imami K, Bhavsar AP, Yu H, Brown NF, Rogers LD, Finlay BB, Foster LJ.
Molecular & Cellular Proteomics 2013 Jun; 12(6):1632.
Application:KA, Human, HeLa cells.
-
Identification of autoantigens specific for systemic lupus erythematosus with central nervous system involvement.
Iizuka N, Okamoto K, Matsushita R, Kimura M, Nagai K, Arito M, Kurokawa MS, Masuko K, Suematsu N, Hirohata S, Kato T.
Lupus 2010 May; 19(6):717.
Application:Func, Human, Serum.
-
Global Impact of Salmonella Pathogenicity Island 2-secreted Effectors on the Host Phosphoproteome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com