HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HSPB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of HSPB1 expression in transfected 293T cell line (H00003315-T01) by HSPB1 MaxPab polyclonal antibody.
Lane 1: HSPB1 transfected lysate(22.80 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-F13A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HSPB1 protein.
Immunogen
HSPB1 (NP_001531.1, 1 a.a. ~ 205 a.a) full-length human protein.
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSPB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of HSPB1 expression in transfected 293T cell line (H00003315-T01) by HSPB1 MaxPab polyclonal antibody.
Lane 1: HSPB1 transfected lysate(22.80 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-F13A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — HSPB1
Entrez GeneID
3315GeneBank Accession#
NM_001540Protein Accession#
NP_001531.1Gene Name
HSPB1
Gene Alias
CMT2F, DKFZp586P1322, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Gene Description
heat shock 27kDa protein 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
Other Designations
OTTHUMP00000024846|estrogen-regulated 24 kDa protein|heat shock 27kD protein 1|heat shock protein beta-1|stress-responsive protein 27
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com