HOXD1 monoclonal antibody (M01), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.
Lane 1: HOXD1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXD1.
Immunogen
HOXD1 (NP_078777, 151 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.
Lane 1: HOXD1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — HOXD1
Entrez GeneID
3231GeneBank Accession#
NM_024501Protein Accession#
NP_078777Gene Name
HOXD1
Gene Alias
HOX4, HOX4G, Hox-4.7
Gene Description
homeobox D1
Omim ID
142987Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. [provided by RefSeq
Other Designations
OTTHUMP00000163336|homeo box 4G|homeo box D1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com