HMGB2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HMGB2 full-length ORF ( AAH00903.2, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
47.19
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HMGB2
Entrez GeneID
3148GeneBank Accession#
BC000903Protein Accession#
AAH00903.2Gene Name
HMGB2
Gene Alias
HMG2
Gene Description
high-mobility group box 2
Omim ID
163906Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq
Other Designations
high-mobility group (nonhistone chromosomal) protein 2
-
Interactome
-
Disease
-
Publication Reference
-
HMGB1-secreting capacity of multiple cell lineages revealed by a novel HMGB1 ELISPOT assay.
Wahamaa H, Vallerskog T, Qin S, Lunderius C, LaRosa G, Andersson U, Harris HE.
Journal of Leukocyte Biology 2006 Sep; 81(1):129.
Application:AP, Mouse, Anti-HMGB1 mAb.
-
HMGB1-secreting capacity of multiple cell lineages revealed by a novel HMGB1 ELISPOT assay.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com