GSR monoclonal antibody (M01), clone 6B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GSR monoclonal antibody (M01), clone 6B4 Western Blot analysis of GSR expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody (M01), clone 6B4.
Lane 1: GSR transfected lysate(56.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSR is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi ( Cat # H00002936-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody (M01), clone 6B4 (Cat # H00002936-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSR.
Immunogen
GSR (NP_000628, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSR monoclonal antibody (M01), clone 6B4 Western Blot analysis of GSR expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody (M01), clone 6B4.
Lane 1: GSR transfected lysate(56.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSR is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi ( Cat # H00002936-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody (M01), clone 6B4 (Cat # H00002936-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — GSR
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com