FCGR2A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FCGR2A partial ORF ( AAH20823, 46 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (62)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FCGR2A
Entrez GeneID
2212GeneBank Accession#
BC020823Protein Accession#
AAH20823Gene Name
FCGR2A
Gene Alias
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2, MGC23887, MGC30032
Gene Description
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Omim ID
146790Gene Ontology
HyperlinkGene Summary
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
Fc fragment of IgG, low affinity IIa, receptor|Fc fragment of IgG, low affinity IIa, receptor for (CD32)|Immunoglobulin G Fc receptor II|OTTHUMP00000032377
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com