ETV1 monoclonal antibody (M01), clone 2A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ETV1.
Immunogen
ETV1 (NP_004947, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ETV1 monoclonal antibody (M01), clone 2A8. Western Blot analysis of ETV1 expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ETV1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ETV1
-
Interactome
-
Disease
-
Publication Reference
-
Low ETV1 mRNA expression is associated with recurrence in gastrointestinal stromal tumors.
Keiichi Sakamaki, Kohei Funasaka, Ryoji Miyahara, Kazuhiro Furukawa, Takeshi Yamamura, Eizaburo Ohno, Masanao Nakamura, Hiroki Kawashima, Yoshiki Hirooka, Mitsuhiro Fujishiro, Hidemi Goto.
Scientific Reports 2020 Sep; 10(1):14767.
Application:WB-Ti, Human, Human gastrointestinal stromal tumors.
-
The ETS transcription factor ETV5 is a target of activated ALK in neuroblastoma contributing to increased tumour aggressiveness.
Mus LM, Lambertz I, Claeys S, Kumps C, Van Loocke W, Van Neste C, Umapathy G, Vaapil M, Bartenhagen C, Laureys G, De Wever O, Bexell D, Fischer M, Hallberg B, Schulte J, De Wilde B, Durinck K, Denecker G, De Preter K, Speleman F.
Scientific Reports 2020 Jan; 10(1):218.
Application:WB-Tr, Human, CLB-GA, NB-1, SH-SY5Y, SK-N-AS cells.
-
Low ETV1 mRNA expression is associated with recurrence in gastrointestinal stromal tumors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com