CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CYP2E1 protein.
Immunogen
CYP2E1 (NP_000764.1, 1 a.a. ~ 493 a.a) full-length human protein.
Sequence
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CYP2E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CYP2E1 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of CYP2E1 expression in transfected 293T cell line (H00001571-T01) by CYP2E1 MaxPab polyclonal antibody.
Lane 1: CYP2E1 transfected lysate(56.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYP2E1
Entrez GeneID
1571GeneBank Accession#
NM_000773.3Protein Accession#
NP_000764.1Gene Name
CYP2E1
Gene Alias
CPE1, CYP2E, P450-J, P450C2E
Gene Description
cytochrome P450, family 2, subfamily E, polypeptide 1
Omim ID
124040Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq
Other Designations
OTTHUMP00000020813|OTTHUMP00000046571|cytochrome P450 2E1|cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1|flavoprotein-linked monooxygenase|microsomal monooxygenase|xenobiotic monooxygenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Resveratrol Ameliorates Experimental Alcoholic Liver Disease by Modulating Oxidative Stress.
Peiyuan H, Zhiping H, Chengjun S, Chunqing W, Bingqing L, Imam MU.
Evidence-Based Complementary and Alternative Medicine : ECAM. 2017 Dec; 2017:4287890.
Application:WB, Human, Liver.
-
Quantification of cytochrome 2E1 in human liver microsomes using a validated indirect ELISA.
De Bock L, Colin P, Boussery K, Van Bocxlaer J.
Journal of Pharmaceutical and Biomedical Analysis 2014 Jan; 88:536.
Application:ELISA, Human, human liver.
-
Resveratrol Ameliorates Experimental Alcoholic Liver Disease by Modulating Oxidative Stress.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com