CTSD MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CTSD protein.
Immunogen
CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein.
Sequence
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in mouse brain.Western Blot (Tissue lysate)
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in human kidney.Western Blot (Cell lysate)
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in IMR-32.Western Blot (Cell lysate)
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of CTSD expression in transfected 293T cell line (H00001509-T01) by CTSD MaxPab polyclonal antibody.
Lane 1: CTSD transfected lysate(44.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CTSD transfected lysate using anti-CTSD MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CTSD purified MaxPab mouse polyclonal antibody (B01P) (H00001509-B01P). -
Gene Info — CTSD
Entrez GeneID
1509GeneBank Accession#
NM_001909Protein Accession#
AAH16320.1Gene Name
CTSD
Gene Alias
CLN10, CPSD, MGC2311
Gene Description
cathepsin D
Gene Ontology
HyperlinkGene Summary
This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease. [provided by RefSeq
Other Designations
lysosomal aspartyl peptidase|lysosomal aspartyl protease
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com