CALB1 monoclonal antibody (M01), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CALB1 expression in transfected 293T cell line by CALB1 monoclonal antibody (M01), clone 1F6.
Lane 1: CALB1 transfected lysate (Predicted MW: 30 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALB1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (56.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CALB1.
Immunogen
CALB1 (NP_004920.1, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (56.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CALB1 expression in transfected 293T cell line by CALB1 monoclonal antibody (M01), clone 1F6.
Lane 1: CALB1 transfected lysate (Predicted MW: 30 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALB1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CALB1
Entrez GeneID
793GeneBank Accession#
NM_004929.2Protein Accession#
NP_004920.1Gene Name
CALB1
Gene Alias
CALB
Gene Description
calbindin 1, 28kDa
Omim ID
114050Gene Ontology
HyperlinkGene Summary
Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. [provided by RefSeq
Other Designations
RTVL-H protein|calbindin 1|calbindin 1, (28kD)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com