CACNB1 monoclonal antibody (M01), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody (M01), clone 1G6.
Lane 1: CACNB1 transfected lysate(65.7 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi ( Cat # H00000782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody (M01), clone 1G6 (Cat # H00000782-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CACNB1.
Immunogen
CACNB1 (NP_000714, 500 a.a. ~ 598 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody (M01), clone 1G6.
Lane 1: CACNB1 transfected lysate(65.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi ( Cat # H00000782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody (M01), clone 1G6 (Cat # H00000782-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CACNB1
Entrez GeneID
782GeneBank Accession#
NM_000723Protein Accession#
NP_000714Gene Name
CACNB1
Gene Alias
CAB1, CACNLB1, CCHLB1, MGC41896
Gene Description
calcium channel, voltage-dependent, beta 1 subunit
Omim ID
114207Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000164286|calcium channel, L type, beta 1 polypeptide|dihydropyridine-sensitive L-type, calcium channel beta-1 subunit
-
Interactome
-
Pathway
-
Publication Reference
-
The {beta}1 subunit of L-type voltage-gated Ca2+ channels independently binds to and inhibits the gating of large-conductance Ca2+-activated K+ channels.
Zou S, Jha S, Kim EY, Dryer SE.
Molecular Pharmacology 2007 Nov; 73(2):369.
Application：IF, WB-Ti, Chicken, Chicken ciliary ganglion neurons.
-
The {beta}1 subunit of L-type voltage-gated Ca2+ channels independently binds to and inhibits the gating of large-conductance Ca2+-activated K+ channels.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com