CACNA1C monoclonal antibody (M20), clone 4D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CACNA1C.
Immunogen
CACNA1C (NP_000710, 2039 a.a. ~ 2138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CACNA1C is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CACNA1C
Entrez GeneID
775GeneBank Accession#
NM_000719Protein Accession#
NP_000710Gene Name
CACNA1C
Gene Alias
CACH2, CACN2, CACNL1A1, CCHL1A1, CaV1.2, MGC120730, TS
Gene Description
calcium channel, voltage-dependent, L type, alpha 1C subunit
Gene Ontology
HyperlinkGene Summary
This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by this gene binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins. [provided by RefSeq
Other Designations
DHPR, alpha-1 subunit|calcium channel, L type, alpha 1 polypeptide, isoform 1, cardic muscle|calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit|voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*|voltage-gated c
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com