RHOC (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RHOC full-length ORF ( AAH07245, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.97
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RHOC
Entrez GeneID
389GeneBank Accession#
BC007245Protein Accession#
AAH07245Gene Name
RHOC
Gene Alias
ARH9, ARHC, H9, MGC1448, MGC61427, RHOH9
Gene Description
ras homolog gene family, member C
Omim ID
165380Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000013675|OTTHUMP00000013676|OTTHUMP00000013802|OTTHUMP00000013805|OTTHUMP00000013807|OTTHUMP00000013809|RAS-related homolog 9|Rho-related GTP-binding protein RhoC|oncogene RHO H9|rhoC GTPase|small GTP binding protein RhoC
-
Interactome
-
Disease
-
Publication Reference
-
Flow Cytometry for Real-Time Measurement of Guanine Nucleotide Binding and Exchange by Ras-like GTPases.
Schwartz SL, Tessema M, Buranda T, Pylypenko O, Rak A, Simons PC, Surviladze Z, Sklar LA, Wandinger-Ness A.
Analytical Biochemistry 2008 Jul; 381(2):258.
Application:Flow Cyt, Func, BODIPY–GTP analogues.
-
Flow Cytometry for Real-Time Measurement of Guanine Nucleotide Binding and Exchange by Ras-like GTPases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com