RHOC monoclonal antibody (M06), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant RHOC.
Immunogen
RHOC (AAH07245, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RHOC is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RHOC on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RHOC
Entrez GeneID
389GeneBank Accession#
BC007245Protein Accession#
AAH07245Gene Name
RHOC
Gene Alias
ARH9, ARHC, H9, MGC1448, MGC61427, RHOH9
Gene Description
ras homolog gene family, member C
Omim ID
165380Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000013675|OTTHUMP00000013676|OTTHUMP00000013802|OTTHUMP00000013805|OTTHUMP00000013807|OTTHUMP00000013809|RAS-related homolog 9|Rho-related GTP-binding protein RhoC|oncogene RHO H9|rhoC GTPase|small GTP binding protein RhoC
-
Interactome
-
Disease
-
Publication Reference
-
Rhos and Rho kinases in the rat prostate: their possible functional roles and distributions.
Saito M, Ohmasa F, Shomori K, Dimitriadis F, Ohiwa H, Shimizu S, Tsounapi P, Kinoshita Y, Satoh K.
Mol Cell Biochem 2011 Jul; 358:207.
Application:IHC, WB-Ti, Rat, Prostate.
-
Rhos and Rho kinases in the rat prostate: their possible functional roles and distributions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com