APOC4 monoclonal antibody (M01), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant APOC4.
Immunogen
APOC4 (AAH20723.1, 27 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of APOC4 expression in transfected 293T cell line by APOC4 monoclonal antibody (M01), clone 3D10.
Lane 1: APOC4 transfected lysate(14.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of APOC4 transfected lysate using anti-APOC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOC4 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — APOC4
Entrez GeneID
346GeneBank Accession#
BC020723Protein Accession#
AAH20723.1Gene Name
APOC4
Gene Alias
-
Gene Description
apolipoprotein C-IV
Omim ID
600745Gene Ontology
HyperlinkGene Summary
Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3-kb gene consisting of 3 exons and 2 introns; it is located 0.5 kb 5' to the APOC2 gene. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Diseases
-
Publication Reference
-
Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins.
Sun HY, Chen SF, Lai MD, Chang TT, Chen TL, Li PY, Shieh DB, Young KC.
Clinica Chimica Acta; International Journal of Clinical Chemistry 2009 Nov; 411(5-6):336.
Application:WB, Human, Human plasma.
-
Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com