ACVR1B monoclonal antibody (M09), clone 1C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Immunogen
ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ACVR1B expression in transfected 293T cell line by ACVR1B monoclonal antibody (M09), clone 1C1.
Lane 1: ACVR1B transfected lysate (Predicted MW: 56.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACVR1B is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between XIAP and ACVR1B. HeLa cells were stained with anti-XIAP rabbit purified polyclonal 1:1200 and anti-ACVR1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ACVR1B
Entrez GeneID
91GeneBank Accession#
BC000254Protein Accession#
AAH00254Gene Name
ACVR1B
Gene Alias
ACTRIB, ACVRLK4, ALK4, SKR2
Gene Description
activin A receptor, type IB
Omim ID
601300Gene Ontology
HyperlinkGene Summary
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed. [provided by RefSeq
Other Designations
activin A receptor, type II-like kinase 4|activin A type IB receptor|activin receptor-like kinase 4|serine(threonine) protein kinase receptor R2
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Activin acutely sensitizes dorsal root ganglion neurons and induces hyperalgesia via PKC-mediated potentiation of transient receptor potential vanilloid I.
Zhu W, Xu P, Cuascut FX, Hall AK, Oxford GS.
Journal of Neuroscience 2007 Dec; 27(50):13770.
Application:IF, IHC, Rat, Rat neurons.
-
Activin acutely sensitizes dorsal root ganglion neurons and induces hyperalgesia via PKC-mediated potentiation of transient receptor potential vanilloid I.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com