ABL2 monoclonal antibody (M03), clone 6D5

Catalog # H00000027-M03

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ABL2 monoclonal antibody (M03), clone 6D5. Western Blot analysis of ABL2 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M03), clone 6D5.

Lane 1: ABL2 transfected lysate(126.7 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi ( Cat # H00000027-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody (M03) clone 6D5 (Cat # H00000027-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-ABL2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

QC Test

Western Blot detection against Immunogen (36.41 KDa) .

  • Specifications

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant ABL2.

    Immunogen

    ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (98); Rat (98)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.41 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    ABL2 monoclonal antibody (M03), clone 6D5. Western Blot analysis of ABL2 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M03), clone 6D5.

    Lane 1: ABL2 transfected lysate(126.7 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi ( Cat # H00000027-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody (M03) clone 6D5 (Cat # H00000027-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-ABL2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — ABL2

    Entrez GeneID

    27

    GeneBank Accession#

    BC065912

    Protein Accession#

    AAH65912

    Gene Name

    ABL2

    Gene Alias

    ABLL, ARG, FLJ22224, FLJ31718, FLJ41441

    Gene Description

    v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)

    Omim ID

    164690

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    Abelson murine leukemia viral (v-abl) oncogene homolog 2|Abelson-related gene protein|OTTHUMP00000033139|arg tyrosine kinase|v-abl Abelson murine leukemia viral oncogene homolog 2

  • Interactomes
  • Pathways
  • Diseases
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All